PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 425aa    MW: 45893.8 Da    PI: 7.7546
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023570.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box201.4e-061760441
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 + C+ +++  + lfC+ + ++lC  C + +H        H++v+
  Pbr023570.1 17 KLCDSCKNSAAALFCRADLTFLCLPCDTRIHIAnklttrHERVS 60
                 68******99*********************3356777788775 PP

2zf-B_box26.99.9e-0959104342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                    +C+ +++ ++   C+ +   lC  C + +H+       H++vp+
  Pbr023570.1  59 VSMCEVCDQAPAAVICKADAAVLCVACKVDIHSAnpltqrHERVPV 104
                  578*****************************66899999999986 PP

3CCT64.72.8e-22351394144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRY+eKrk+RkF+K+irY sRK++Ae+RpR+KGrF+k++
  Pbr023570.1 351 REARVLRYREKRKNRKFQKTIRYVSRKVYAETRPRIKGRFTKRT 394
                  9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.2E-121461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4241461IPR000315B-box-type zinc finger
PfamPF006438.2E-61760IPR000315B-box-type zinc finger
CDDcd000212.57E-81861No hitNo description
PROSITE profilePS5011910.9557104IPR000315B-box-type zinc finger
PfamPF006437.9E-759104IPR000315B-box-type zinc finger
CDDcd000218.08E-961104No hitNo description
SMARTSM003361.2E-862104IPR000315B-box-type zinc finger
PfamPF062036.2E-17351393IPR010402CCT domain
PROSITE profilePS5101716.122351393IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MGLKGGWSAA AVGLVAKLCD SCKNSAAALF CRADLTFLCL PCDTRIHIAN KLTTRHERVS  60
MCEVCDQAPA AVICKADAAV LCVACKVDIH SANPLTQRHE RVPVEPFYDS AESIIAKSTA  120
AAPSFVGAAI NYLVPNGNVL SNTKDVDNDP ASNWLIPNSN FNSKLPMDIA PNITKSSGDL  180
FFPEMDLLLE FNNPNSIHTI SGPGTDSVVP VQTDPIPPPS LKMNHNISGP ADQNCFDMDF  240
CGSKFSSSFS YPTQSLSQSV SSSSLDVGVV PDQNSLSDIS YPFGRTACNS ISEPGDVSYS  300
FGQKTSNNVS EPGDISYPFG QKASNNVLEP SARVSATPAS QPATQLCGLN REARVLRYRE  360
KRKNRKFQKT IRYVSRKVYA ETRPRIKGRF TKRTKTETET FDLIYGSGSA TFISDPQFAV  420
VPTF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009379498.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X1
TrEMBLD9ZIW70.0D9ZIW7_MALDO; COL domain class transcription factor
STRINGGLYMA13G01290.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.14e-92CONSTANS-like 5